Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBL1 Rabbit Polyclonal Antibody (HRP)

CTNNBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAP, P14L, PP8304, C20orf33, dJ633O20.1

UniProt

Q8WYA6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CTNNBL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 0.2mg/mL
BNUB2168-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Metastasis, unknown source
CB501433 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
UGT3A2 Human Gene Knockout Kit (CRISPR)
KN423207 1 Kit

UGT3A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-(1R,3r,5S)-8-Isopropyl-8-azabicyclo[3.2.1]octan-3-yl 3-Hydroxy-2-phenylpropanoate
TRC-I824270-5MG 5 mg

(S)-(1R,3r,5S)-8-Isopropyl-8-azabicyclo[3.2.1]octan-3-yl 3-Hydroxy-2-phenylpropanoate

Sign In for Pricing
View Details
Cyclin C (CCNC) (NM_005190) Human Over-expression Lysate
LY401590 100 µg

Cyclin C (CCNC) (NM_005190) Human Over-expression Lysate

Sign In for Pricing
View Details
p40/RABEPK Recombinant Rabbit Monoclonal Antibody [JE35-06]
HA722449 100 µL

p40/RABEPK Recombinant Rabbit Monoclonal Antibody [JE35-06]

Sign In for Pricing
View Details