Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIS1 Rabbit Polyclonal Antibody (Biotin)

FIS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TTC11, CGI-135

UniProt

Q9Y3D6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_057152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin I Antibody (HRP)
KH-2678-01 50 μL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
Cardiac Troponin I Antibody (HRP)
KH-2678-02 100 µL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
Cardiac Troponin I Antibody (HRP)
KH-2678-03 1 mL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
TNF alpha (TNF) (NM_000594) Human Recombinant Protein
TP750117 50 µg

TNF alpha (TNF) (NM_000594) Human Recombinant Protein

Sign In for Pricing
View Details
WDR38 (NM_001045476) Human Over-expression Lysate
LY420750 100 µg

WDR38 (NM_001045476) Human Over-expression Lysate

Sign In for Pricing
View Details
LBX2 Human Gene Knockout Kit (CRISPR)
KN422072 1 Kit

LBX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details