Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf57 Rabbit Polyclonal Antibody (HRP)

C16orf57 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PN, Mpn1, HVSL1, hUsb1, C16orf57

UniProt

Q9BQ65

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avibactam Sodium Salt
TRC-A794850-1MG 1 mg

Avibactam Sodium Salt

Sign In for Pricing
View Details
Yes1 Mouse Gene Knockout Kit (CRISPR)
KN519546 1 Kit

Yes1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Striatin (STRN) (NM_003162) Human Over-expression Lysate
LY418852 100 µg

Striatin (STRN) (NM_003162) Human Over-expression Lysate

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL
BNC400501-500 1x 500 µL

Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COMT Rabbit Polyclonal Antibody
TA365674 100 µL

COMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADK Antibody
KC-3778-01 50 μL

ADK Antibody

Sign In for Pricing
View Details