Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH13 Rabbit Polyclonal Antibody (HRP)

RDH13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDR7C3

UniProt

Q8NBN7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[1- (Fluoromethyl) cyclopropyl]methanesulfonyl chloride
PCC96395-01 50 mg

[1- (Fluoromethyl) cyclopropyl]methanesulfonyl chloride

Sign In for Pricing
View Details
[1- (Fluoromethyl) cyclopropyl]methanesulfonyl chloride
PCC96395-02 0.5 g

[1- (Fluoromethyl) cyclopropyl]methanesulfonyl chloride

Sign In for Pricing
View Details
Recombinant Rabbit A-kinase anchor protein 9 (AKAP9), partial
MBS1403528 Inquire

Recombinant Rabbit A-kinase anchor protein 9 (AKAP9), partial

Sign In for Pricing
View Details
Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit
orb2812952-01 48 Tests

Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit

Sign In for Pricing
View Details
Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit
orb2812952-02 96 Tests

Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit

Sign In for Pricing
View Details
Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit
orb2812952-03 5 x 96 T

Rat High Mobility Group Protein 1 (HMG-1) ELISA Kit

Sign In for Pricing
View Details