Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufa3 Rabbit Polyclonal Antibody (HRP)

Ndufa3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1010001M12Rik, 1700022J01Rik

UniProt

Q9CQ91

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ndufa3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079624

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Laminin Beta 3 (LAMb3) Protein
abx167245-01 10 µg

Mouse Laminin Beta 3 (LAMb3) Protein

Sign In for Pricing
View Details
Mouse Laminin Beta 3 (LAMb3) Protein
abx167245-02 50 µg

Mouse Laminin Beta 3 (LAMb3) Protein

Sign In for Pricing
View Details
Mouse Laminin Beta 3 (LAMb3) Protein
abx167245-03 100 µg

Mouse Laminin Beta 3 (LAMb3) Protein

Sign In for Pricing
View Details
Mouse Laminin Beta 3 (LAMb3) Protein
abx167245-04 200 µg

Mouse Laminin Beta 3 (LAMb3) Protein

Sign In for Pricing
View Details
Mouse Laminin Beta 3 (LAMb3) Protein
abx167245-05 500 µg

Mouse Laminin Beta 3 (LAMb3) Protein

Sign In for Pricing
View Details
TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 650)
MBS6225163-01 0.1 mL

TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 650)

Sign In for Pricing
View Details