Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufa3 Rabbit Polyclonal Antibody (HRP)

Ndufa3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1010001M12Rik, 1700022J01Rik

UniProt

Q9CQ91

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ndufa3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079624

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR133-set siRNA/shRNA/RNAi Lentivector (Human)
22502091 4x 500 ng

GPR133-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse Anti-Mouse I-Ek-PE
MBS673651-01 0.1 mg

Mouse Anti-Mouse I-Ek-PE

Sign In for Pricing
View Details
Mouse Anti-Mouse I-Ek-PE
MBS673651-02 5x 0.1 mg

Mouse Anti-Mouse I-Ek-PE

Sign In for Pricing
View Details
Recombinant B. anthracis Single-stranded DNA-binding protein Protein, His-SUMO, E.coli-1mg
QP7787-ec-1mg 1mg

Recombinant B. anthracis Single-stranded DNA-binding protein Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
Recombinant Human Growth/ differentiation factor 2 Protein, His, Yeast-50ug
QP9936-ye-50ug 50ug

Recombinant Human Growth/ differentiation factor 2 Protein, His, Yeast-50ug

Sign In for Pricing
View Details
Atoh8 3'UTR GFP Stable Cell Line
TU152288 1.0 mL

Atoh8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details