Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUGCT Rabbit Polyclonal Antibody (HRP)

SUGCT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GA3, ORF19, DERP13, C7orf10

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C7orf10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSVNRNKKSIAVNIKDPKGVKIIYCSITGYGQTGPISQRAGYDAVASAVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ILF2 / Interleukin enhancer-binding factor 2 ELISA Kit
orb1653482 96 Tests

Human ILF2 / Interleukin enhancer-binding factor 2 ELISA Kit

Sign In for Pricing
View Details
ATP2A3 Antibody - N-terminal region
OABB02107-100UG 100 µg/Vial

ATP2A3 Antibody - N-terminal region

Sign In for Pricing
View Details
Aif1 Recombinant Protein
OPCA01455-20UG 20 µg

Aif1 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal IL-15 R alpha Antibody (JM7A4) [HRP]
NBP1-43238H 0.1 mL

Mouse Monoclonal IL-15 R alpha Antibody (JM7A4) [HRP]

Sign In for Pricing
View Details
KIF24, NT (KIF24, C9orf48, Kinesin-like protein KIF24) (MaxLight 490) discontinued
037438-ML490 100 µL

KIF24, NT (KIF24, C9orf48, Kinesin-like protein KIF24) (MaxLight 490) discontinued

Sign In for Pricing
View Details
XRCC5 Antibody - middle region (ARP87061_P050)
ARP87061_P050 100 µL

XRCC5 Antibody - middle region (ARP87061_P050)

Sign In for Pricing
View Details