Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H12A Rabbit Polyclonal Antibody (Biotin)

ZC3H12A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Reg1, MCPIP, MCPIP1, MCPIP-1, dJ423B22.1

UniProt

P82912

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLT

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_789775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV676021 1.0 µg DNA

KCNJ13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZBTB7C Antibody
E51A14715 100 µL

ZBTB7C Antibody

Sign In for Pricing
View Details
Anti Mouse CD22 Flow Cytometry Monoclonal Clone CY341 AF647 Ready To Use 200 Tests
IMSAMSCD22CY341CAF647200 200 Tests

Anti Mouse CD22 Flow Cytometry Monoclonal Clone CY341 AF647 Ready To Use 200 Tests

Sign In for Pricing
View Details
P18SRP (SFRS12-Interacting Protein 1, FLJ36754, MGC131910, MGC150548, MGC150549, P18SRP)
249692 50 µL

P18SRP (SFRS12-Interacting Protein 1, FLJ36754, MGC131910, MGC150548, MGC150549, P18SRP)

Sign In for Pricing
View Details
PHD3 Antibody [H19K23]
C22049-20uL 20 µL

PHD3 Antibody [H19K23]

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) SUMO1 Polyclonal Antibody
MBS7199505 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) SUMO1 Polyclonal Antibody

Sign In for Pricing
View Details