Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA5 Rabbit Polyclonal Antibody (HRP)

NCOA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIA, bA465L10.6

UniProt

Q9HCD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066018

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methamphetamine Monoclonal Antibody
TBS10154-0.2mg 0.2 mg

Methamphetamine Monoclonal Antibody

Sign In for Pricing
View Details
AGXT2L1 Blocking Peptide
33R-4639 0.1 mg

AGXT2L1 Blocking Peptide

Sign In for Pricing
View Details
Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit
MBS7233837-01 48 Well

Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details
Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit
MBS7233837-02 96 Well

Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details
Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit
MBS7233837-03 5x 96 Well

Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details
Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit
MBS7233837-04 10x 96 Well

Monkey Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details