Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQOR Rabbit Polyclonal Antibody (Biotin)

SQOR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sq, Sqrdl, 0610039J17Rik, 4930557M22Rik

UniProt

Q9R112

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-African malaria mosquito AGAP000550-PA Antibody, HRP Conjugate
DZ41130-HRP 200 µL/Vial

Anti-African malaria mosquito AGAP000550-PA Antibody, HRP Conjugate

Sign In for Pricing
View Details
3-Oxo-21α-methoxy-24,25,26,27-tetranortirucall-7-ene-23 (21) -lactone
HY-N4162 1 Each

3-Oxo-21α-methoxy-24,25,26,27-tetranortirucall-7-ene-23 (21) -lactone

Sign In for Pricing
View Details
GRM1, CT (GRM1, GPRC1A, MGLUR1, Metabotropic glutamate receptor 1) (MaxLight 750) discontinued
036313-ML750 100 µL

GRM1, CT (GRM1, GPRC1A, MGLUR1, Metabotropic glutamate receptor 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PCBD2 Knockout A549 Polyclonal Cells
ARG10619 1 Million

PCBD2 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
SCRN3 Rabbit pAb, Pacific Blue conjugated
orb2851847 100 µL

SCRN3 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CREB1, Recombinant, Human, aa1-341, His-Tag (Cyclic AMP-responsive Element-binding Protein 1)
372862-01 20 µg

CREB1, Recombinant, Human, aa1-341, His-Tag (Cyclic AMP-responsive Element-binding Protein 1)

Sign In for Pricing
View Details