Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39B Rabbit Polyclonal Antibody (HRP)

TTC39B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf52

UniProt

E9PC88

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VWNGFSIVSKRKDLSENLLVTVEKAEAALQSQNFNSFSVDDECLVKLLKG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kif2c qPCR Primer Pair
QM42294S 200 Tests

Mouse Kif2c qPCR Primer Pair

Sign In for Pricing
View Details
Alizarine Complexon Indicator for EDTA titration
00098 00001 1 g

Alizarine Complexon Indicator for EDTA titration

Sign In for Pricing
View Details
Recombinant Human AKT3 (N-GST tag)
Z500007 10 µg

Recombinant Human AKT3 (N-GST tag)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)
MBS7012712-01 0.02 mg

Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)
MBS7012712-02 0.1 mg

Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)
MBS7012712-03 5x 0.1 mg

Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)

Sign In for Pricing
View Details