Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMG9 Rabbit Polyclonal Antibody (HRP)

SMG9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HBMS, C19orf61, F17127_1

UniProt

Q9H0W8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDASEETSTSVMQKTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-N kappa-p100 (S865) antibody
STJ90341 200 µl

Anti-Phospho-N kappa-p100 (S865) antibody

Sign In for Pricing
View Details
Mouse Zfp248 (NM_028335) AAV Particle
MR209048A1V 250 µL

Mouse Zfp248 (NM_028335) AAV Particle

Sign In for Pricing
View Details
IFRD1 Antibody
OAAN03676-200UL 200 µL

IFRD1 Antibody

Sign In for Pricing
View Details
Hpd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3368807 1.0 µg DNA

Hpd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ERBB3 (Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)
144493 100 µg

ERBB3 (Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3)

Sign In for Pricing
View Details
IHH (Indian Hedgehog Protein, HHG-2, Indian Hedgehog Protein N-product, Indian Hedgehog Protein C-product) (MaxLight 490)
MBS6201368-01 0.1 mL

IHH (Indian Hedgehog Protein, HHG-2, Indian Hedgehog Protein N-product, Indian Hedgehog Protein C-product) (MaxLight 490)

Sign In for Pricing
View Details