Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMG9 Rabbit Polyclonal Antibody (HRP)

SMG9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HBMS, C19orf61, F17127_1

UniProt

Q9H0W8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDASEETSTSVMQKTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HPS1 Protein - (Dry Ice)
H00003257-P01-10ug 10 µg

Recombinant Human HPS1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Chicken Immunosuppressive Acidic Protein ELISA kit
GTR10457201 96 Well

Chicken Immunosuppressive Acidic Protein ELISA kit

Sign In for Pricing
View Details
RNU7-81P sgRNA CRISPR Lentivector (Human) (Target 2)
K1862603 1.0 µg DNA

RNU7-81P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal Thrombopoietin R/Tpo R Antibody (S03-1C9)
NBP3-19792-100ul 100 µL

Rabbit Monoclonal Thrombopoietin R/Tpo R Antibody (S03-1C9)

Sign In for Pricing
View Details
RTEL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
42860064 1.0 µg DNA

RTEL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD33 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2042R-APC-Cy5.5 100 µL

CD33 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details