Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMWD Rabbit Polyclonal Antibody (HRP)

DMWD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMRN9, DMR-N9, gene59, D19S593E

UniProt

Q09019

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVAAEPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDYL2 antibody
70R-51170 100 µL

CDYL2 antibody

Sign In for Pricing
View Details
AZI2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62723R-BF350-01 20 µL

AZI2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
AZI2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62723R-BF350-02 100 µL

AZI2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
2-Oxobutanoic acid
BUP19935 1 mL

2-Oxobutanoic acid

Sign In for Pricing
View Details
Phospho-Androgen Receptor (Ser597) Rabbit Polyclonal Antibody (Cy5.5)
orb1048882 100 µL

Phospho-Androgen Receptor (Ser597) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Bovine Enhancer of yellow 2 transcription factor homolog (ENY2)
MBS1291541-01 0.02 mg (E-Coli)

Recombinant Bovine Enhancer of yellow 2 transcription factor homolog (ENY2)

Sign In for Pricing
View Details