Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMWD Rabbit Polyclonal Antibody (HRP)

DMWD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMRN9, DMR-N9, gene59, D19S593E

UniProt

Q09019

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVAAEPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS16 (NM_001020) Human Tagged ORF Clone Lentiviral Particle
RC203475L3V 200 µL

RPS16 (NM_001020) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C18orf19 AAV siRNA Pooled Vector
14025161 1.0 µg

C18orf19 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SLC6A1 peptide
orb382335-01 1 mg

SLC6A1 peptide

Sign In for Pricing
View Details
SLC6A1 peptide
orb382335-02 5 mg

SLC6A1 peptide

Sign In for Pricing
View Details
MHC Class II I-Ab Mouse Monoclonal Antibody [Clone ID: 25-5-16S]
SM080B 100 µg

MHC Class II I-Ab Mouse Monoclonal Antibody [Clone ID: 25-5-16S]

Sign In for Pricing
View Details
ARHGAP23 Polyclonal Antibody
E20-70319 100 µg

ARHGAP23 Polyclonal Antibody

Sign In for Pricing
View Details