Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Rabbit Polyclonal Antibody (HRP)

SNTB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNT3, SNTL, SNT2B2, EST25263, D16S2531E

UniProt

Q13425

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSM

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteocalcin Recombinant Antibody, APC Conjugated
bsm-62874R-APC 100 µL

Osteocalcin Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
PTP4A1P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38132061 1.0 µg DNA

PTP4A1P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SH3PXD2B Rabbit Polyclonal Antibody (Center)
E28PB3691 100 µL

SH3PXD2B Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
Analogue Control Fixed Speed
MIX1982 1 Each

Analogue Control Fixed Speed

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0284097 (DDB_G0284097), partial
MBS1304456 Inquire

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0284097 (DDB_G0284097), partial

Sign In for Pricing
View Details
Recombinant Shigella Sonnei gpt Protein (aa 1-152)
VAng-Lsx09730-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei gpt Protein (aa 1-152)

Sign In for Pricing
View Details