Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRUB1 Rabbit Polyclonal Antibody (HRP)

TRUB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PUS4

UniProt

Q8WWH5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KWTIDDIAQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKRED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_631908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Band 3 (SLC4A1) (NM_000342) Human Tagged ORF Clone
RC218312 10 µg

Band 3 (SLC4A1) (NM_000342) Human Tagged ORF Clone

Sign In for Pricing
View Details
LRIT3 Human shRNA Lentiviral Particle (Locus ID 345193)
TL307886V 500 µL Each

LRIT3 Human shRNA Lentiviral Particle (Locus ID 345193)

Sign In for Pricing
View Details
STNL P034-148x210-PP-CRD/1 AC Signs
826507 Card of 1 Pictogram(s)

STNL P034-148x210-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
RBP1 (NM_002899) Human Recombinant Protein
PROTP09455 20 µg

RBP1 (NM_002899) Human Recombinant Protein

Sign In for Pricing
View Details
Dsg3 shRNA (h) Lentiviral Particles
sc-43115-V 200 µL

Dsg3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Mitochondrial group I intron splicing factor CCM1 (CCM1), partial
MBS1290104 Inquire

Recombinant Debaryomyces hansenii Mitochondrial group I intron splicing factor CCM1 (CCM1), partial

Sign In for Pricing
View Details