Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Rabbit Polyclonal Antibody (Biotin)

CD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T11, SRBC, LFA-2

UniProt

P06729

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001758

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS30 (NM_016640) Human Untagged Clone
SC324401 10 µg

MRPS30 (NM_016640) Human Untagged Clone

Sign In for Pricing
View Details
Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA500053BM 100 µL

Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
Neuromedin U (Rat) - I-125 Labeled Purified IgG
T-G-046-41 10 µCi

Neuromedin U (Rat) - I-125 Labeled Purified IgG

Sign In for Pricing
View Details
CDH10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15648124 3x 1.0µg DNA

CDH10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
FTMT CRISPRa sgRNA lentivector (set of three targets)(Rat)
21049126 3x 1.0µg DNA

FTMT CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Iguratimod Impurity 109
RM-I071934-01 10 mg

Iguratimod Impurity 109

Sign In for Pricing
View Details