Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sms Rabbit Polyclonal Antibody (Biotin)

Sms Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gy, Sp, gyro, SPMSY, SpmST, AI427066

UniProt

P97355

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Floor Standing Shaking Incubator BSFT-106
BSFT-106 1 Unit

Floor Standing Shaking Incubator BSFT-106

Sign In for Pricing
View Details
Rhodopsin Antibody [Rho 1D4], Mouse IgG1
24-341 0.2 mg

Rhodopsin Antibody [Rho 1D4], Mouse IgG1

Sign In for Pricing
View Details
Bovine Creatine kinase B-type ELISA Kit
MBS9428031-01 96 Tests

Bovine Creatine kinase B-type ELISA Kit

Sign In for Pricing
View Details
Bovine Creatine kinase B-type ELISA Kit
MBS9428031-02 5x 96 Tests

Bovine Creatine kinase B-type ELISA Kit

Sign In for Pricing
View Details
Human CYP7A1 (Cytochrome P450 7A1) ELISA Kit
MBS2505687-01 24 Tests (Limit 1)

Human CYP7A1 (Cytochrome P450 7A1) ELISA Kit

Sign In for Pricing
View Details
Human CYP7A1 (Cytochrome P450 7A1) ELISA Kit
MBS2505687-02 48 Tests

Human CYP7A1 (Cytochrome P450 7A1) ELISA Kit

Sign In for Pricing
View Details