Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE5A Rabbit Polyclonal Antibody (Biotin)

PDE5A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CN5A, PDE5, CGB-PDE

UniProt

O76074

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_246273

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB26 Protein Vector (Mouse) (pPM-C-HA)
PV221656 500 ng

RAB26 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ras-related Protein Rab-10, Recombinant, Mouse, aa1-200, His-Tag
586113-01 20 µg

Ras-related Protein Rab-10, Recombinant, Mouse, aa1-200, His-Tag

Sign In for Pricing
View Details
Ras-related Protein Rab-10, Recombinant, Mouse, aa1-200, His-Tag
586113-02 100 µg

Ras-related Protein Rab-10, Recombinant, Mouse, aa1-200, His-Tag

Sign In for Pricing
View Details
Lentiviral mouse Pheta2 shRNA (UAS) - Lentiviral mouse Pheta2 shRNA (UAS, GFP) plasmid
GTR15134794 1 Vial

Lentiviral mouse Pheta2 shRNA (UAS) - Lentiviral mouse Pheta2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Nuclear Receptor LXR beta, NT (NR1H2, Liver X Receptor beta, LX Receptor beta, LXR beta, LXRB, LXR-b, NER1, NERI, NER-I, Nuclear Orphan Receptor LXR beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Oxysterols Receptor LXR beta, RIP15, Steroid Hormone Nuclear Receptor NER, Ubiquitously Expressed Nuclear Receptor, UENR, UNR) (AP) discontinued
N6889-82N-AP 200 µL

Nuclear Receptor LXR beta, NT (NR1H2, Liver X Receptor beta, LX Receptor beta, LXR beta, LXRB, LXR-b, NER1, NERI, NER-I, Nuclear Orphan Receptor LXR beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Oxysterols Receptor LXR beta, RIP15, Steroid Hormone Nuclear Receptor NER, Ubiquitously Expressed Nuclear Receptor, UENR, UNR) (AP) discontinued

Sign In for Pricing
View Details
MYO1D Rabbit pAb
orb2712981-01 50 µL

MYO1D Rabbit pAb

Sign In for Pricing
View Details