Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPC Rabbit Polyclonal Antibody (Biotin)

LIPC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HL, HTGL, LIPH, HDLCQ12

UniProt

P11150

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of LIPC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Goat Anti-HTATSF1 Antibody
AMM05377G 0.1 mg

Polyclonal Goat Anti-HTATSF1 Antibody

Sign In for Pricing
View Details
SERPINB1 Human shRNA Lentiviral Particle (Locus ID 1992)
TL301760V 500 µL Each

SERPINB1 Human shRNA Lentiviral Particle (Locus ID 1992)

Sign In for Pricing
View Details
TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFS
MBS6503259-01 0.1 mL

TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFS

Sign In for Pricing
View Details
TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFS
MBS6503259-02 5x 0.1 mL

TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFS

Sign In for Pricing
View Details
Mouse Anti-Goat IgM Antibody (H+L), Cy7 Conjugated
bs-0370M-Cy7 200 µL

Mouse Anti-Goat IgM Antibody (H+L), Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Rat Interleukin-3 beta
AP60228 Inquire

Recombinant Rat Interleukin-3 beta

Sign In for Pricing
View Details