Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Rabbit Polyclonal Antibody (HRP)

TCP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha

UniProt

P17987

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_110379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sesn2 shRNA (UAS) - Lentiviral mouse Sesn2 shRNA (UAS, iRFP) plasmid
GTR15301699 1 Vial

Lentiviral mouse Sesn2 shRNA (UAS) - Lentiviral mouse Sesn2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Goat Leukemia Inhibitory Factor (LIF) Protein
abx654177-01 1 mg

Goat Leukemia Inhibitory Factor (LIF) Protein

Sign In for Pricing
View Details
Goat Leukemia Inhibitory Factor (LIF) Protein
abx654177-02 5 mg

Goat Leukemia Inhibitory Factor (LIF) Protein

Sign In for Pricing
View Details
2-Chloro-4-cyclobutoxybenzoic acid
RDC28603-01 50 mg

2-Chloro-4-cyclobutoxybenzoic acid

Sign In for Pricing
View Details
2-Chloro-4-cyclobutoxybenzoic acid
RDC28603-02 0.5 g

2-Chloro-4-cyclobutoxybenzoic acid

Sign In for Pricing
View Details
[Lys8]-Vasopressin peptide
orb1090548 5 mg

[Lys8]-Vasopressin peptide

Sign In for Pricing
View Details