Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFRC Rabbit Polyclonal Antibody (Biotin)

TFRC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T9, TR, TFR, p90, CD71, TFR1, TRFR, IMD46

UniProt

P02786

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPRE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_003225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit
MBS2157254-01 96 Tests

Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit
MBS2157254-02 5x 96 Tests

Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit
MBS2157254-03 10x 96 Tests

Melanoma Associated ME20 (ME20M) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Lentiviral mouse Ass1 shRNA (UAS) - Lentiviral mouse Ass1 shRNA (UAS, iRFP) (25)
GTR15187958 1 Vial

Lentiviral mouse Ass1 shRNA (UAS) - Lentiviral mouse Ass1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Karyopherin Alpha 2 ELISA Kit
MBS086466-01 48 Well

Mouse Karyopherin Alpha 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Karyopherin Alpha 2 ELISA Kit
MBS086466-02 96 Well

Mouse Karyopherin Alpha 2 ELISA Kit

Sign In for Pricing
View Details