Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCAR2 Rabbit Polyclonal Antibody (HRP)

HCAR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HCA2, HM74a, HM74b, PUMAG, NIACR1, Puma-g, GPR109A

UniProt

Q8TDS4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_808219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), 0.2mg/mL
BNUB3339-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), 0.2mg/mL

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF405S conjugate, 0.1mg/mL
BNC043014-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASAHL (NAAA) Human Gene Knockout Kit (CRISPR)
KN218139LP 1 Kit

ASAHL (NAAA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)
KN203062BN 1 Kit

NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HNRPM (HNRNPM) (NM_031203) Human Over-expression Lysate
LC403103 20 µg

HNRPM (HNRNPM) (NM_031203) Human Over-expression Lysate

Sign In for Pricing
View Details
D-Glyceraldehyde (>80%)
TRC-G598200-250MG 250 mg

D-Glyceraldehyde (>80%)

Sign In for Pricing
View Details