Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Rabbit Polyclonal Antibody (FITC)

SNX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VPS5, HsT17379

UniProt

Q13596

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADAT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001229862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinogen-Binding Peptide 1mg
A22854-1 1 mg

Fibrinogen-Binding Peptide 1mg

Sign In for Pricing
View Details
SERPINH1 (Serpin H1, Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2) (APC)
MBS6437178-01 0.1 mL

SERPINH1 (Serpin H1, Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2) (APC)

Sign In for Pricing
View Details
SERPINH1 (Serpin H1, Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2) (APC)
MBS6437178-02 5x 0.1 mL

SERPINH1 (Serpin H1, Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2) (APC)

Sign In for Pricing
View Details
PSD Rabbit Polyclonal Antibody (Fluoro647)
orb3114064 100 µg

PSD Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
PLV3-U6-BAIAP2-sgRNA1-Cas9-EGFP-Puro Plasmid
PVT80219 2 µg

PLV3-U6-BAIAP2-sgRNA1-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody [Clone ID: OTI9C2]
CF800518 100 µg

BCL10 Mouse Monoclonal Antibody [Clone ID: OTI9C2]

Sign In for Pricing
View Details