Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL19 Rabbit Polyclonal Antibody (Biotin)

IL19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MDA1, NG.1, ZMDA1, IL-10C

UniProt

Q5VUT3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_715639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human pro-BDNF (pro Brain Derived Neurotrophic Factor) ELISA Kit
EH4255 96 Tests

Human pro-BDNF (pro Brain Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)
MBS2042200-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)
MBS2042200-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)
MBS2042200-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)
MBS2042200-04 1 mL

Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)
MBS2042200-05 5 mL

Cy3-Linked Polyclonal Antibody to Myelin Oligodendrocyte Glycoprotein (MOG)

Sign In for Pricing
View Details