Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGA2 Rabbit Polyclonal Antibody (FITC)

GGA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VEAR

UniProt

Q9UJY4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GGA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNL2, NT (GLRX3, PICOT, TXNL2, Glutaredoxin-3, PKC-interacting cousin of thioredoxin, PKC-theta-interacting protein, Thioredoxin-like protein 2) (APC)
MBS6360399-01 0.2 mL

TXNL2, NT (GLRX3, PICOT, TXNL2, Glutaredoxin-3, PKC-interacting cousin of thioredoxin, PKC-theta-interacting protein, Thioredoxin-like protein 2) (APC)

Sign In for Pricing
View Details
TXNL2, NT (GLRX3, PICOT, TXNL2, Glutaredoxin-3, PKC-interacting cousin of thioredoxin, PKC-theta-interacting protein, Thioredoxin-like protein 2) (APC)
MBS6360399-02 5x 0.2 mL

TXNL2, NT (GLRX3, PICOT, TXNL2, Glutaredoxin-3, PKC-interacting cousin of thioredoxin, PKC-theta-interacting protein, Thioredoxin-like protein 2) (APC)

Sign In for Pricing
View Details
AlphaBioCoat Precoated T-25 Flasks
AC001-T25 Pack of 10

AlphaBioCoat Precoated T-25 Flasks

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-01 0.05 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-02 0.2 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-03 0.5 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details