Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Rabbit Polyclonal Antibody (Biotin)

RAB1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H0U4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_112243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OXSM Antibody [Alexa Fluor 350]
NBP2-97290AF350 0.1 mL

Rabbit Polyclonal OXSM Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
DUX4, CT (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (MaxLight 650) discontinued
034866-ML650 100 µL

DUX4, CT (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ATP1A2 Conjugated Antibody
orb1612850 100 µL

ATP1A2 Conjugated Antibody

Sign In for Pricing
View Details
Sodium Chloride Strip Test
EOK1950 100 Tests

Sodium Chloride Strip Test

Sign In for Pricing
View Details
Rat Schistosome Antibody (SCH-IgM) ELISA Kit
MBS9392771-01 48 Strip Well

Rat Schistosome Antibody (SCH-IgM) ELISA Kit

Sign In for Pricing
View Details
Rat Schistosome Antibody (SCH-IgM) ELISA Kit
MBS9392771-02 96 Strip Well

Rat Schistosome Antibody (SCH-IgM) ELISA Kit

Sign In for Pricing
View Details