Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP3 Rabbit Polyclonal Antibody (Biotin)

CRISP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Aeg2, CRS3, SGP28, CRISP-3, dJ442L6.3

UniProt

P54108

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRISP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial
CSB-EP009911HU-01 20 µg

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial

Sign In for Pricing
View Details
Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial
CSB-EP009911HU-02 100 µg

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial

Sign In for Pricing
View Details
Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial
CSB-EP009911HU-03 1 mg

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial

Sign In for Pricing
View Details
ViPrimePLUS Haemophilus parasuis (Glasser_x0019_ s Disease) qPCR Test Kit
VICH003 1 Kit

ViPrimePLUS Haemophilus parasuis (Glasser_x0019_ s Disease) qPCR Test Kit

Sign In for Pricing
View Details
CDH23 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2505479 100 µL

CDH23 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
RPL36AP37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV780734 1.0 µg DNA

RPL36AP37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details