Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Rabbit Polyclonal Antibody (HRP)

DYRK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CEL Protein, Untagged, Native Protein-10ug
QP11385-10ug 10ug

Recombinant Human CEL Protein, Untagged, Native Protein-10ug

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, Receptor Type, S Antibody
abx114885 100 µL

Protein Tyrosine Phosphatase, Receptor Type, S Antibody

Sign In for Pricing
View Details
Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit
MBS9326219-01 48 Well

Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit

Sign In for Pricing
View Details
Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit
MBS9326219-02 96 Well

Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit

Sign In for Pricing
View Details
Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit
MBS9326219-03 5x 96 Well

Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit

Sign In for Pricing
View Details
Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit
MBS9326219-04 10x 96 Well

Human Putative ATP-binding cassette sub-family A member 11, ABCA11 ELISA Kit

Sign In for Pricing
View Details