Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Rabbit Polyclonal Antibody (HRP)

STXBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

UniProt

Q15833

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_008880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BenchMixer™ Vortexer 115V
BV1000 1 Each

BenchMixer™ Vortexer 115V

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF594 conjugate, 0.1mg/mL
BNC943813-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS809276 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF568 conjugate, 0.1mg/mL
BNC682988-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IDH1 Antibody
KC-3956-01 50 μL

IDH1 Antibody

Sign In for Pricing
View Details
IDH1 Antibody
KC-3956-02 100 µL

IDH1 Antibody

Sign In for Pricing
View Details