Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USO1 Rabbit Polyclonal Antibody (FITC)

USO1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TAP, VDP, P115

UniProt

O60763

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human USO1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QTDRSDSEIIGYALDILYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MRPL24 qPCR Primer Pair
QH51601S 200 Tests

Human MRPL24 qPCR Primer Pair

Sign In for Pricing
View Details
Sulfatase 1 (SULF1) (NM_015170) Human Recombinant Protein
E45H30183E1 50 µg

Sulfatase 1 (SULF1) (NM_015170) Human Recombinant Protein

Sign In for Pricing
View Details
INPP5E Antibody
E94863 100 µg

INPP5E Antibody

Sign In for Pricing
View Details
FOXJ3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20778061 1.0 µg DNA

FOXJ3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Vwa5b2 shRNA (UAS) - Lentiviral mouse Vwa5b2 shRNA (UAS, iRFP) plasmid
GTR15127036 1 Vial

Lentiviral mouse Vwa5b2 shRNA (UAS) - Lentiviral mouse Vwa5b2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human KAT5 sgRNA gene knockout kit - Lentiviral human KAT5 sgRNA gene knockout kit (100)
GTR15373048 1 Vial

Lentiviral human KAT5 sgRNA gene knockout kit - Lentiviral human KAT5 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details