Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADM2 Rabbit Polyclonal Antibody (FITC)

ADM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AM2, dJ579N16.4

UniProt

Q7Z4H4

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC

NCBI Accession Number

NP_079142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP170L, ID (CEP170P1, CEP170L, KIAA0470L, Cep170-like protein, CEP170 pseudogene 1) (APC) discontinued
033779-APC 200 µL

CEP170L, ID (CEP170P1, CEP170L, KIAA0470L, Cep170-like protein, CEP170 pseudogene 1) (APC) discontinued

Sign In for Pricing
View Details
ACADSB Knockout MES-OV Polyclonal Cells
ARG24019 1 Million

ACADSB Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
SLC22A3 Recombinant Protein (Rat)
RP229118 100 µg

SLC22A3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Serum Regenerating islet-derived protein 3-beta,REG3B ELISA KIT
JOT-EK4653Hu-01 48 Well

Human Serum Regenerating islet-derived protein 3-beta,REG3B ELISA KIT

Sign In for Pricing
View Details
Human Serum Regenerating islet-derived protein 3-beta,REG3B ELISA KIT
JOT-EK4653Hu-02 96 Well

Human Serum Regenerating islet-derived protein 3-beta,REG3B ELISA KIT

Sign In for Pricing
View Details
CNTFR Protein, Rat, Recombinant (His)
TMPY-02008-01 5 µg

CNTFR Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details