Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10

Product Specifications

Product Name Alternative

((1->3) -beta-glucan endohydrolase 10) ((1->3) -beta-glucanase 10) (Beta-1,3-endoglucanase 10) (Beta-1,3-glucanase 10) (Putative plasmodesmal associated protein) (AtBG_ppap)

Abbreviation

Recombinant Mouse-ear cress Glucan endo-1,3-beta-glucosidase 10 protein

UniProt

Q9FHX5

Expression Region

27-425aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR

Tag

N-terminal 6xHis-EGFP-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Plasmodesmal-associated membrane beta-1,3-glucanase involved in plasmodesmal callose degradation and functions in the gating of plasmodesmata.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.5 kDa

References & Citations

"Subcellular dynamics and role of Arabidopsis beta-1,3-glucanases in cell-to-cell movement of tobamoviruses." Zavaliev R., Levy A., Gera A., Epel B.L. Mol. Plant Microbe Interact. 26:1016-1030 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERKL Polyclonal Antibody
RD88436A-01 60 μL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
CERKL Polyclonal Antibody
RD88436A-02 120 μL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
CERKL Polyclonal Antibody
RD88436A-03 200 µL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
Vmn1r122 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3068103 1.0 µg DNA

Vmn1r122 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
HRASLS Protein Vector (Rat) (pPM-C-HA)
PV273420 500 ng

HRASLS Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Goat beta Nerve growth factor (beta-NGF) ELISA Kit
MBS2605601-01 48 Well

Goat beta Nerve growth factor (beta-NGF) ELISA Kit

Sign In for Pricing
View Details