Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Rabbit Polyclonal Antibody (FITC)

IL26 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_060872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOG Rabbit Monoclonal Antibody [Clone ID: 23GB1370]
TA424772 100 µL

EXOG Rabbit Monoclonal Antibody [Clone ID: 23GB1370]

Sign In for Pricing
View Details
IL17F Mouse Monoclonal Antibody [Clone ID: OTI2E2]
CF815338 100 µg

IL17F Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF640R conjugate, 0.1mg/mL
BNC401897-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CASP3 Rabbit Monoclonal Antibody [Clone ID: 23GB715]
TA425142 100 µL

CASP3 Rabbit Monoclonal Antibody [Clone ID: 23GB715]

Sign In for Pricing
View Details
Recombinant Human EPO Receptor/EPOR Protein (Fc Tag)
PKSH031462 100 µg

Recombinant Human EPO Receptor/EPOR Protein (Fc Tag)

Sign In for Pricing
View Details
PEX5 (NM_001131024) Human Over-expression Lysate
LC427362 20 µg

PEX5 (NM_001131024) Human Over-expression Lysate

Sign In for Pricing
View Details