Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR2 Rabbit Polyclonal Antibody (Biotin)

S1PR2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EDG5, H218, LPB2, S1P2, AGR16, EDG-5, DFNB68, Gpcr13

UniProt

O95136

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human S1PR2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004221

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Formin Binding Protein 1 ELISA Kit
MBS089952-01 48 Well

Human Formin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Formin Binding Protein 1 ELISA Kit
MBS089952-02 96 Well

Human Formin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Formin Binding Protein 1 ELISA Kit
MBS089952-03 5x 96 Well

Human Formin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Formin Binding Protein 1 ELISA Kit
MBS089952-04 10x 96 Well

Human Formin Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Depdc1b shRNA (UAS) - Lentiviral mouse Depdc1b shRNA (UAS, iRFP) (100)
GTR15180039 1 Vial

Lentiviral mouse Depdc1b shRNA (UAS) - Lentiviral mouse Depdc1b shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Calcium Sensing Receptor Antibody
MBS9412540-01 0.1 mL

Calcium Sensing Receptor Antibody

Sign In for Pricing
View Details