Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGP1 Rabbit Polyclonal Antibody (FITC)

RGP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA0258

UniProt

Q92546

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem88b (NM_001033394) Mouse Tagged ORF Clone
MG215170 10 µg

Tmem88b (NM_001033394) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LASS2 (Ceramide Synthase 2, CerS2, LAG1 Longevity Assurance Homolog 2, SP260, Tumor Metastasis-suppressor Gene 1 Protein, CERS2, TMSG1, FLJ10243, L3, MGC987) (MaxLight 650)
129011-ML650 100 µL

LASS2 (Ceramide Synthase 2, CerS2, LAG1 Longevity Assurance Homolog 2, SP260, Tumor Metastasis-suppressor Gene 1 Protein, CERS2, TMSG1, FLJ10243, L3, MGC987) (MaxLight 650)

Sign In for Pricing
View Details
GC (Vitamin D-binding Protein, DBP, VDB, Gc-globulin, Group-specific Component)
V2130-10D 100 µg

GC (Vitamin D-binding Protein, DBP, VDB, Gc-globulin, Group-specific Component)

Sign In for Pricing
View Details
Rat cysteinyl aspartate specific Proteinases 12, Caspase-12 GENLISA ELISA
KLR0279 96 Well

Rat cysteinyl aspartate specific Proteinases 12, Caspase-12 GENLISA ELISA

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Apoptotic Peptidase Activating Factor 1 (APAF1)
MBS2163942-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Apoptotic Peptidase Activating Factor 1 (APAF1)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Apoptotic Peptidase Activating Factor 1 (APAF1)
MBS2163942-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Apoptotic Peptidase Activating Factor 1 (APAF1)

Sign In for Pricing
View Details