Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIL1 Rabbit Polyclonal Antibody (FITC)

VIL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VIL, D2S1471

UniProt

P09327

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Medium for Dog Vaginal Smooth Muscle Cells (VSMC)
abx710329-01 100 mL

Medium for Dog Vaginal Smooth Muscle Cells (VSMC)

Sign In for Pricing
View Details
Medium for Dog Vaginal Smooth Muscle Cells (VSMC)
abx710329-02 500 mL

Medium for Dog Vaginal Smooth Muscle Cells (VSMC)

Sign In for Pricing
View Details
Medium for Dog Vaginal Smooth Muscle Cells (VSMC)
abx710329-03 1 L

Medium for Dog Vaginal Smooth Muscle Cells (VSMC)

Sign In for Pricing
View Details
GAMT (NM_000156) Human Over-expression Lysate
LS002593-20ug 20 µg

GAMT (NM_000156) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-Tau (S199) Monoclonal Antibody, AbBy Fluor™ 647 Conjugated
bsm-63066R-BF647 100 µL

Phospho-Tau (S199) Monoclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638383 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details