Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REPS2 Rabbit Polyclonal Antibody (HRP)

REPS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POB1

UniProt

Q8NFH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human REPS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial
MBS959135-01 0.02 mg (E-Coli)

Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial

Sign In for Pricing
View Details
Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial
MBS959135-02 0.1 mg (E-Coli)

Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial

Sign In for Pricing
View Details
Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial
MBS959135-03 1 mg (E-Coli)

Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial

Sign In for Pricing
View Details
Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial
MBS959135-04 5x 1 mg (E-Coli)

Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial

Sign In for Pricing
View Details
TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (PE)
MBS6440025-01 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (PE)

Sign In for Pricing
View Details
TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (PE)
MBS6440025-02 5x 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (PE)

Sign In for Pricing
View Details