Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Rabbit Polyclonal Antibody (HRP)

TFPT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FB1, amida, INO80F

UniProt

P0C1Z6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromo-3- (trifluoromethyl) benzamide
JRB69074-01 1 g

4-Bromo-3- (trifluoromethyl) benzamide

Sign In for Pricing
View Details
4-Bromo-3- (trifluoromethyl) benzamide
JRB69074-02 10 g

4-Bromo-3- (trifluoromethyl) benzamide

Sign In for Pricing
View Details
1-Butyl-2,3-dimethylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0104-HP-0250 250 g

1-Butyl-2,3-dimethylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
Recombinant Blochmannia floridanus Sulfite reductase [NADPH] hemoprotein beta-component (cysI), partial
MBS1312934 Inquire

Recombinant Blochmannia floridanus Sulfite reductase [NADPH] hemoprotein beta-component (cysI), partial

Sign In for Pricing
View Details
Bovine PKB ELISA Kit
EBP0668 96 Tests

Bovine PKB ELISA Kit

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_000516) Human Over-expression Lysate
LS002778-20ug 20 µg

G protein alpha S (GNAS) (NM_000516) Human Over-expression Lysate

Sign In for Pricing
View Details