Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN4 Rabbit Polyclonal Antibody (FITC)

MATN4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ14417, HE6WCR54

UniProt

A6NNA4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_085095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB p100 / p52 Polyclonal Antibody
E-AB-65807-01 60 µL

NFkB p100 / p52 Polyclonal Antibody

Sign In for Pricing
View Details
NFkB p100 / p52 Polyclonal Antibody
E-AB-65807-02 120 µL

NFkB p100 / p52 Polyclonal Antibody

Sign In for Pricing
View Details
NFkB p100 / p52 Polyclonal Antibody
E-AB-65807-03 200 µL

NFkB p100 / p52 Polyclonal Antibody

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (rLGRN/1821), CF740 conjugate, 0.1mg/mL
BNC743608-500 1x 500 µL

Langerin / CD207 (Marker of Langerhans Cells) (rLGRN/1821), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF640R conjugate, 0.1mg/mL
BNC403175-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), CF740 conjugate, 0.1mg/mL
BNC741727-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details