Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42BPB Rabbit Polyclonal Antibody (HRP)

CDC42BPB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRCKB

UniProt

Q9Y5S2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDC42BPB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

194kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBSS, w/o: Ca and Mg, w/o: NaHCO3, Powder
P04-33010P 10 L

HBSS, w/o: Ca and Mg, w/o: NaHCO3, Powder

Sign In for Pricing
View Details
SNHG7 Protein Vector (Human) (pPM-C-His)
PV039364 500 ng

SNHG7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
XKR3, CT (XKR3, XRG3, XK-related protein 3, X Kell blood group-related 3, XTES) (FITC) discontinued
043919-FITC 200 µL

XKR3, CT (XKR3, XRG3, XK-related protein 3, X Kell blood group-related 3, XTES) (FITC) discontinued

Sign In for Pricing
View Details
MSF (A555) (MSF, S eptin-9, KIAA0991, MSF) (MaxLight 650) discontinued
038627-ML650 100 µL

MSF (A555) (MSF, S eptin-9, KIAA0991, MSF) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TUBGCP5 (Gamma-tubulin Complex Component 5, GCP5, GCP-5, KIAA1899) (FITC)
134903-FITC 100 µL

TUBGCP5 (Gamma-tubulin Complex Component 5, GCP5, GCP-5, KIAA1899) (FITC)

Sign In for Pricing
View Details
GLO4 Antibody
orb846411 2 mg

GLO4 Antibody

Sign In for Pricing
View Details