Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR34 Rabbit Polyclonal Antibody (HRP)

GPR34 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LYPSR1

UniProt

Q9UPC5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR34

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 405)
MBS6346685-01 0.1 mL

SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 405)

Sign In for Pricing
View Details
SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 405)
MBS6346685-02 5x 0.1 mL

SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 405)

Sign In for Pricing
View Details
TP1 Polyclonal Antibody
UB-GEN-2086 100 µL

TP1 Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit For Synaptojanin-1
E15652m 96 Tests

ELISA Kit For Synaptojanin-1

Sign In for Pricing
View Details
WSE-4025 HorizeBLOT 2M-R
2322466 1 Each

WSE-4025 HorizeBLOT 2M-R

Sign In for Pricing
View Details
Recombinant Psychrobacter arcticus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1413299-01 0.02 mg (E-Coli)

Recombinant Psychrobacter arcticus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details