Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CISD1 Rabbit Polyclonal Antibody (HRP)

CISD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZCD1, MDS029, C10orf70, mitoNEET

UniProt

Q9NZ45

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CISD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLII

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB16D Antibody
orb839350 2 mg

RAB16D Antibody

Sign In for Pricing
View Details
Anti-Rad51 Antibody Picoband® Fluoro647 Conjugated
A00088-Fluoro647 100 µg/Vial

Anti-Rad51 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Rat Creb3 Pre-designed siRNA Set A
SI203235A 1 Each

Rat Creb3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human LCK shRNA (UAS) - Lentiviral human LCK shRNA (UAS, GFP) (25)
GTR15133352 1 Vial

Lentiviral human LCK shRNA (UAS) - Lentiviral human LCK shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Cap1 shRNA (UAS) - Lentiviral mouse Cap1 shRNA (UAS, iRFP) (25)
GTR15204038 1 Vial

Lentiviral mouse Cap1 shRNA (UAS) - Lentiviral mouse Cap1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
1- (Bromomethyl) -2-Fluoro-4-Nitrobenzene
FB85001 1000 mg

1- (Bromomethyl) -2-Fluoro-4-Nitrobenzene

Sign In for Pricing
View Details