Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Rabbit Polyclonal Antibody (HRP)

MOB1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MOB1, MATS1, Mob4B, C2orf6, MOBK1B, MOBKL1B

UniProt

Q9H8S9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MOB1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC3D Protein Vector (Human) (pPB-His-GST)
PV322839 500 ng

APOBEC3D Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Recombinant Candida Albicans TUP1 Protein (aa 1-511)
VAng-Lsx06043-inquire Inquire

Recombinant Candida Albicans TUP1 Protein (aa 1-511)

Sign In for Pricing
View Details
RIBC1 (m) -PR
sc-152890-PR 10 µM - 20 µL

RIBC1 (m) -PR

Sign In for Pricing
View Details
Ksr1 3'UTR Luciferase Stable Cell Line
TU206905 1.0 mL

Ksr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human CNIH1 Protein Lysate
MBS139657-01 0.02 mg

Human CNIH1 Protein Lysate

Sign In for Pricing
View Details
Human CNIH1 Protein Lysate
MBS139657-02 5x 0.02 mg

Human CNIH1 Protein Lysate

Sign In for Pricing
View Details