Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLDIP2 Rabbit Polyclonal Antibody (HRP)

POLDIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P38, POLD4, PDIP38

UniProt

Q9Y2S7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLDIP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr545 Mouse shRNA Plasmid (Locus ID 258837)
TL507917 1 Kit

Olfr545 Mouse shRNA Plasmid (Locus ID 258837)

Sign In for Pricing
View Details
Integrin β7 shRNA Plasmid (m)
sc-37260-SH 20 µg

Integrin β7 shRNA Plasmid (m)

Sign In for Pricing
View Details
GNG4 Antibody
RQ6130 100 µg

GNG4 Antibody

Sign In for Pricing
View Details
Concanavalin A Lectin ex. Canavalia Ensiformis Type 1 for cell culture, 64ug/ml, (BET) 0.05EU/mg
81395-1 40 Mg

Concanavalin A Lectin ex. Canavalia Ensiformis Type 1 for cell culture, 64ug/ml, (BET) 0.05EU/mg

Sign In for Pricing
View Details
Recombinant Early B-Cell Factor 1 (EBF1)
SIPB770Hu01-01 10 µg

Recombinant Early B-Cell Factor 1 (EBF1)

Sign In for Pricing
View Details
Recombinant Early B-Cell Factor 1 (EBF1)
SIPB770Hu01-02 50 µg

Recombinant Early B-Cell Factor 1 (EBF1)

Sign In for Pricing
View Details