Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLDIP2 Rabbit Polyclonal Antibody (HRP)

POLDIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P38, POLD4, PDIP38

UniProt

Q9Y2S7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLDIP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Agouti Related Protein (AGRP) ELISA Kit
DL-AGRP-Hu-01 48 Tests

Human Agouti Related Protein (AGRP) ELISA Kit

Sign In for Pricing
View Details
Human Agouti Related Protein (AGRP) ELISA Kit
DL-AGRP-Hu-02 96 Tests

Human Agouti Related Protein (AGRP) ELISA Kit

Sign In for Pricing
View Details
V-9302 25mg
A19704-25 25 mg

V-9302 25mg

Sign In for Pricing
View Details
Rabbit Polyclonal SERPINB10 Antibody [Alexa Fluor 405]
NBP2-24382AF405 0.1 mL

Rabbit Polyclonal SERPINB10 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Beta Mannosidase (β Manase) Chicken ELISA Kit
B7644 96 Tests

Beta Mannosidase (β Manase) Chicken ELISA Kit

Sign In for Pricing
View Details
Alpha smooth muscle Actin Mouse Monoclonal Antibody (BF488)
orb1586771 100 µL

Alpha smooth muscle Actin Mouse Monoclonal Antibody (BF488)

Sign In for Pricing
View Details