Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTA1 Rabbit Polyclonal Antibody (HRP)

SNTA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNT1, LQT12, TACIP1, dJ1187J4.5

UniProt

Q13424

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SNTA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPGPTPRNFSEAKHMSLKMAYVSKRCTPNDPEPRYLEICSADGQDTLFLR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003089.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human A Disintegrin Like And Metalloproteinase Thrombospondin Type 1 Motif 7 ELISA Kit
BG-HUM10011 1 Each

Human A Disintegrin Like And Metalloproteinase Thrombospondin Type 1 Motif 7 ELISA Kit

Sign In for Pricing
View Details
Anti-DGK beta Antibody
MBS9239106-01 0.05 mL

Anti-DGK beta Antibody

Sign In for Pricing
View Details
Anti-DGK beta Antibody
MBS9239106-02 0.1 mL

Anti-DGK beta Antibody

Sign In for Pricing
View Details
Anti-DGK beta Antibody
MBS9239106-03 5x 0.1 mL

Anti-DGK beta Antibody

Sign In for Pricing
View Details
Desmethyl-VS-5584 50mg
A10900-50 50 mg

Desmethyl-VS-5584 50mg

Sign In for Pricing
View Details
Lentiviral mouse Tectb shRNA (UAS) - Lentiviral mouse Tectb shRNA (UAS, RFP) (100)
GTR15262332 1 Vial

Lentiviral mouse Tectb shRNA (UAS) - Lentiviral mouse Tectb shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details