Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A10 Rabbit Polyclonal Antibody (HRP)

SLC25A10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DIC, MTDPS19

UniProt

Q9UBX3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036272

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit
ELK2383-01 48 Tests

Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit

Sign In for Pricing
View Details
Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit
ELK2383-02 96 Tests

Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit

Sign In for Pricing
View Details
Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit
ELK2383-03 5x 96 Tests

Human CCR6 (Chemokine C-C-Motif Receptor 6) ELISA Kit

Sign In for Pricing
View Details
Peroxiredoxin 4 (PRDX4) (NM_006406) Human Over-expression Lysate
LC401927 20 µg

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Over-expression Lysate

Sign In for Pricing
View Details
Matrin 3 (MATR3) (NM_018834) Human Untagged Clone
SC113375 10 µg

Matrin 3 (MATR3) (NM_018834) Human Untagged Clone

Sign In for Pricing
View Details
ZBTB7B, ID (Zinc Finger And BTB Domain-containing Protein 7B, Zinc Finger Protein 67 Homolog, Zfp-67, Zinc Finger And BTB Domain-containing Protein 15, Zinc Finger Protein Th-POK, T-helper-inducing POZ/Krueppel-like Factor, Krueppel-related Zinc Finger Protein cKrox, hcKrox, ZBTB15, ZFP67) (MaxLight 650) discontinued
Z0737-67A-ML650 100 µL

ZBTB7B, ID (Zinc Finger And BTB Domain-containing Protein 7B, Zinc Finger Protein 67 Homolog, Zfp-67, Zinc Finger And BTB Domain-containing Protein 15, Zinc Finger Protein Th-POK, T-helper-inducing POZ/Krueppel-like Factor, Krueppel-related Zinc Finger Protein cKrox, hcKrox, ZBTB15, ZFP67) (MaxLight 650) discontinued

Sign In for Pricing
View Details