Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD4 Rabbit Polyclonal Antibody (HRP)

TMOD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SK-TMOD

UniProt

Q9NZQ9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TMOD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNI

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: OTI2E1]
TA805199 100 µL

hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: OTI2E1]

Sign In for Pricing
View Details
GPR37 Blocking Peptide
MBS9625143-01 1 mg

GPR37 Blocking Peptide

Sign In for Pricing
View Details
GPR37 Blocking Peptide
MBS9625143-02 5x 1 mg

GPR37 Blocking Peptide

Sign In for Pricing
View Details
U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1, FP793, Splicing Factor U2AF 35kD Subunit, U2 Auxiliary Factor 35kD Subunit, U2AF35, U2 snRNP Auxiliary Factor Small Subunit, U2AFBP) (MaxLight 405) discontinued
134964-ML405 100 µL

U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1, FP793, Splicing Factor U2AF 35kD Subunit, U2 Auxiliary Factor 35kD Subunit, U2AF35, U2 snRNP Auxiliary Factor Small Subunit, U2AFBP) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human Origin recognition complex subunit 1 (ORC1), partial
orb2659557-01 20 µg

Recombinant Human Origin recognition complex subunit 1 (ORC1), partial

Sign In for Pricing
View Details
Recombinant Human Origin recognition complex subunit 1 (ORC1), partial
orb2659557-02 100 µg

Recombinant Human Origin recognition complex subunit 1 (ORC1), partial

Sign In for Pricing
View Details