Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei 60 kDa chaperonin (groL), partial

Product Specifications

Product Name Alternative

(60 kDa chaperonin) (Chaperonin-60) (Cpn60)

Abbreviation

Recombinant Lacticaseibacillus casei groEL protein, partial

Gene Name

GroEL

UniProt

B3W9W7

Expression Region

182-374aa

Organism

Lacticaseibacillus casei (strain BL23) (Lactobacillus casei)

Target Sequence

DTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDDPYILITDKKISNIQDILPLLQEIVQQGKALLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIATLTGGTVISSDLGLDLKDTKLEQLGRAGKVTVTKDNTTIVDGAGSKDAIAERVNIIKKQIDDTTSDFDREKLQERLAKLAGGV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Together with its co-chaperonin GroES, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.4 kDa

References & Citations

"Lactobacillus casei BL23 complete genome sequence." Maze A., Boel G., Bourand A., Loux V., Gibrat J.F., Zuniga M., Hartke A., Deutscher J. Submitted (JUN-2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chikungunya Virus CHIKV E2 Protein, Untagged, E.coli-1mg
QP11406-1mg 1mg

Recombinant Chikungunya Virus CHIKV E2 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Lentiviral mouse Fndc10 shRNA (UAS) - Lentiviral mouse Fndc10 shRNA (UAS, iRFP) (25)
GTR15280538 1 Vial

Lentiviral mouse Fndc10 shRNA (UAS) - Lentiviral mouse Fndc10 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Hsa-miR-4433b-5p antagomir
HY-RI01035A-01 5 nmol

Hsa-miR-4433b-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-4433b-5p antagomir
HY-RI01035A-02 20 nmol

Hsa-miR-4433b-5p antagomir

Sign In for Pricing
View Details
GSTM4 Peptide - middle region
MBS3245663-01 0.1 mg

GSTM4 Peptide - middle region

Sign In for Pricing
View Details
GSTM4 Peptide - middle region
MBS3245663-02 5x 0.1 mg

GSTM4 Peptide - middle region

Sign In for Pricing
View Details